Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RASSF4 Peptide - middle region

RASSF4 Peptide - middle region

Product Specifications

UniProt

P50749

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RASSF4 Rabbit Polyclonal Antibody (orb589092) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_114412.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TKSDASCMSQRRPKCRAPGEAQRIRRHRFSINGHFYNHKTSVFTPAYGSV

More Discoveries

Explore Other Products

Browse additional items from our catalog

2X PCR Pre-Mix 3 (High-Taq) w/o Band Sharpener 5 x 1ml
9K-002-0013 5X1mL, 5ml

2X PCR Pre-Mix 3 (High-Taq) w/o Band Sharpener 5 x 1ml

Sign In for Pricing
View Details
ST-836 hydrochloride 10mg
A15249-10 10 mg

ST-836 hydrochloride 10mg

Sign In for Pricing
View Details
DEFA1 Antibody
orb3162726-01 50 µL

DEFA1 Antibody

Sign In for Pricing
View Details
DEFA1 Antibody
orb3162726-02 100 µL

DEFA1 Antibody

Sign In for Pricing
View Details
Sorbs3 (NM_001005762) Rat Tagged Lenti ORF Clone
RR208054L4 10 µg

Sorbs3 (NM_001005762) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Anti-JPH4 antibody
STJ112371 100 µl

Anti-JPH4 antibody

Sign In for Pricing
View Details