Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RILPL2 Peptide - middle region

RILPL2 Peptide - middle region

Product Specifications

UniProt

Q5EBL4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RILPL2 Rabbit Polyclonal Antibody (orb589094) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_659495.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LRKEVEGLRRQSPPASGEVNLGPNKMVVDLTDPNRPRFTLQELRDVLQER

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-Chloro-2-thiothinone (hydrochloride)
HY-158927-01 1 mg

5-Chloro-2-thiothinone (hydrochloride)

Sign In for Pricing
View Details
5-Chloro-2-thiothinone (hydrochloride)
HY-158927-02 5 mg

5-Chloro-2-thiothinone (hydrochloride)

Sign In for Pricing
View Details
IFIT1 Knockout A549 Polyclonal Cells
ARG34065 1 Million

IFIT1 Knockout A549 Polyclonal Cells

Sign In for Pricing
View Details
Lung Lysate
orb1672896 0.1 mg

Lung Lysate

Sign In for Pricing
View Details
Tubes, Combustion, Nuffield
2067710/2 1 Each

Tubes, Combustion, Nuffield

Sign In for Pricing
View Details
EZBlock™ T20 (TBS) Blocking Buffer
2140-1000 1000 mL

EZBlock™ T20 (TBS) Blocking Buffer

Sign In for Pricing
View Details