Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAP6D1 Peptide - middle region

MAP6D1 Peptide - middle region

Product Specifications

UniProt

Q9H9H5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MAP6D1 Rabbit Polyclonal Antibody (orb55769) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079147.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AAAAVTTSYRQEFQAWTGVKPSRSTKTKPARVITTHTSGWDSSPGAGFQV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNMT1 Rabbit mAb
F0279-100ul 100 µL

DNMT1 Rabbit mAb

Sign In for Pricing
View Details
2-Chloro-4-fluoro-5-methoxyphenylboronic acid
GAC35546-01 0.5 g

2-Chloro-4-fluoro-5-methoxyphenylboronic acid

Sign In for Pricing
View Details
2-Chloro-4-fluoro-5-methoxyphenylboronic acid
GAC35546-02 5 g

2-Chloro-4-fluoro-5-methoxyphenylboronic acid

Sign In for Pricing
View Details
Defb41 3'UTR Luciferase Stable Cell Line
TU203326 1.0 mL

Defb41 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Apalutamide Impurity 2
RM-A561002-01 10 mg

Apalutamide Impurity 2

Sign In for Pricing
View Details
Apalutamide Impurity 2
RM-A561002-02 25 mg

Apalutamide Impurity 2

Sign In for Pricing
View Details