Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAP6D1 Peptide - middle region

MAP6D1 Peptide - middle region

Product Specifications

UniProt

Q9H9H5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MAP6D1 Rabbit Polyclonal Antibody (orb55769) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079147.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AAAAVTTSYRQEFQAWTGVKPSRSTKTKPARVITTHTSGWDSSPGAGFQV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Interleukin 1 Receptor accessory protein-Like 1 (IL1RAPL1) Human ELISA Kit
E4052 96 Tests

Interleukin 1 Receptor accessory protein-Like 1 (IL1RAPL1) Human ELISA Kit

Sign In for Pricing
View Details
Sephs2 Mouse Pre-designed siRNA Set A
HY-RS21928 1 Set

Sephs2 Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details
Lenti-UbC-Blank Lentivirus
LVP689 4x 500 µL

Lenti-UbC-Blank Lentivirus

Sign In for Pricing
View Details
IL7R alpha Rabbit Polyclonal Antibody (PE)
orb2618027 100 µg

IL7R alpha Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Human GNL2 Pre-designed siRNA Set A
SI006396A 1 Each

Human GNL2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
2-Amino-1- (4-bromophenyl) ethanol hydrochloride
BDA00853-01 0.5 g

2-Amino-1- (4-bromophenyl) ethanol hydrochloride

Sign In for Pricing
View Details