FASTK Peptide - N-terminal region
FASTK Peptide - N-terminal region
Product Specifications
UniProt
Q69YS8
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with FASTK Rabbit Polyclonal Antibody (orb589098) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001245390.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: CLGPSKWGDRPVGGGPSAGPVQGLQRLLEQAKSPGELLRWLGQNPSKVRA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MP0256J Each
Magic™ Membrane Protein Human ACKR1 (Atypical chemokine receptor 1 (Duffy blood group))
Sign In for Pricing
View Details 479209 100 µL
DDX50 (ATP-Dependent RNA Helicase DDX50, DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 50)
Sign In for Pricing
View Details 
K1843608 1.0 µg DNA
RNR1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
Sign In for Pricing
View Details 