Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNT2 Peptide - middle region

KCNT2 Peptide - middle region

Product Specifications

UniProt

Q3SY61

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KCNT2 Rabbit Polyclonal Antibody (orb589103) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001274748.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TDICFYINITKEENSAFKNQDQQRKSNVSRSFYHGPSRLPVHSIIASMGT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Intestine-Specific Homeobox (ISX) ELISA Kit
MBS9933121-01 48 Well

Sheep Intestine-Specific Homeobox (ISX) ELISA Kit

Sign In for Pricing
View Details
Sheep Intestine-Specific Homeobox (ISX) ELISA Kit
MBS9933121-02 96 Well

Sheep Intestine-Specific Homeobox (ISX) ELISA Kit

Sign In for Pricing
View Details
Sheep Intestine-Specific Homeobox (ISX) ELISA Kit
MBS9933121-03 5x 96 Well

Sheep Intestine-Specific Homeobox (ISX) ELISA Kit

Sign In for Pricing
View Details
Sheep Intestine-Specific Homeobox (ISX) ELISA Kit
MBS9933121-04 10x 96 Well

Sheep Intestine-Specific Homeobox (ISX) ELISA Kit

Sign In for Pricing
View Details
DASK1-VHL
HY-174858 1 Each

DASK1-VHL

Sign In for Pricing
View Details
Elf3 (NM_001163131) Mouse Tagged Lenti ORF Clone
MR223180L3 10 µg

Elf3 (NM_001163131) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details