Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNT2 Peptide - middle region

KCNT2 Peptide - middle region

Product Specifications

UniProt

Q3SY61

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KCNT2 Rabbit Polyclonal Antibody (orb589103) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001274748.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TDICFYINITKEENSAFKNQDQQRKSNVSRSFYHGPSRLPVHSIIASMGT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNY5P8 sgRNA CRISPR Lentivector (Human) (Target 1)
K1867202 1.0 µg DNA

RNY5P8 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Zzz3 sgRNA CRISPR Lentivector (Rat) (Target 3)
K6239804 1.0 µg DNA

Zzz3 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
C6orf220 sgRNA CRISPR Lentivector (Human) (Target 2)
K0252103 1.0 µg DNA

C6orf220 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
ZNF420 Polyclonal Antibody, RBITC Conjugated
bs-7092R-RBITC 100 µL

ZNF420 Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal FIH-1/HIF-1AN Antibody [CoraFluor 1]
NBP2-98999CL1 0.1 mL

Rabbit Polyclonal FIH-1/HIF-1AN Antibody [CoraFluor 1]

Sign In for Pricing
View Details
Dicer (r) -PR
sc-270275-PR 10 µM - 20 µL

Dicer (r) -PR

Sign In for Pricing
View Details