Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PYGL Peptide - middle region

PYGL Peptide - middle region

Product Specifications

UniProt

Q6P1L4

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PYGL Rabbit Polyclonal Antibody (orb589106) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001157412.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EYGIFNQKIRDGWQVEEADDWLRYGNPWEKSRPEFMLPVHFYGKVEHTNT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Boc-D-Tyr(Me)-OH
A6624-1000 1 g

Boc-D-Tyr(Me)-OH

Sign In for Pricing
View Details
Human CellExp™ FGF-8b, Human Recombinant
6451-10 each

Human CellExp™ FGF-8b, Human Recombinant

Sign In for Pricing
View Details
PIP5KL1 Antibody
CSB-PA018030GA01HU 100 µL

PIP5KL1 Antibody

Sign In for Pricing
View Details
Creb1 ORF Vector (Mouse) (pORF)
ORF041977 1.0 µg DNA

Creb1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Anti-E4F1 Antibody Picoband®
A04930-carrier-free 100 µg/Vial

Anti-E4F1 Antibody Picoband®

Sign In for Pricing
View Details
LNK Blocking Peptide
CBP3038-01 1 mg

LNK Blocking Peptide

Sign In for Pricing
View Details