PYGL Peptide - middle region
PYGL Peptide - middle region
Product Specifications
UniProt
Q6P1L4
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PYGL Rabbit Polyclonal Antibody (orb589106) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001157412.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EYGIFNQKIRDGWQVEEADDWLRYGNPWEKSRPEFMLPVHFYGKVEHTNT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb1003250 100 µL
Guanylyl Cyclase beta 1 Rabbit Polyclonal Antibody (APC)
Sign In for Pricing
View Details 
GTR15201147 1 Vial
Lentiviral mouse Por shRNA (UAS) - Lentiviral mouse Por shRNA (UAS, iRFP) (100)
Sign In for Pricing
View Details T5595-5126B 5 Slides
Tissue, Section, Human Disease, Hypertension, Heart, Artery (Frozen) HisTekTM
Sign In for Pricing
View Details abx585840-02 5x 96 Tests
Mouse Interferon Alpha 14 (IFNA14) ELISA Kit
Sign In for Pricing
View Details abx585840-03 10x 96 Tests
Mouse Interferon Alpha 14 (IFNA14) ELISA Kit
Sign In for Pricing
View Details