Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ISLR Peptide - middle region

ISLR Peptide - middle region

Product Specifications

UniProt

O14498

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ISLR Rabbit Polyclonal Antibody (orb589107) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005536.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EGTYSCLATNELGSAESSVDVALATPGEGGEDTLGRRFHGKAVEGKGCYT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hamster Prefoldin Subunit 2 (PFDN2) ELISA Kit
MBS9395825-01 48 Well

Hamster Prefoldin Subunit 2 (PFDN2) ELISA Kit

Sign In for Pricing
View Details
Hamster Prefoldin Subunit 2 (PFDN2) ELISA Kit
MBS9395825-02 96 Well

Hamster Prefoldin Subunit 2 (PFDN2) ELISA Kit

Sign In for Pricing
View Details
Hamster Prefoldin Subunit 2 (PFDN2) ELISA Kit
MBS9395825-03 5x 96 Well

Hamster Prefoldin Subunit 2 (PFDN2) ELISA Kit

Sign In for Pricing
View Details
Hamster Prefoldin Subunit 2 (PFDN2) ELISA Kit
MBS9395825-04 10x 96 Well

Hamster Prefoldin Subunit 2 (PFDN2) ELISA Kit

Sign In for Pricing
View Details
Anti-SSSCA1/ZNRD2 Antibody Picoband®, APC Conjugate
A14259-1-APC 100 µg/Vial

Anti-SSSCA1/ZNRD2 Antibody Picoband®, APC Conjugate

Sign In for Pricing
View Details
Pafah2 3'UTR Lenti-reporter-Luc Vector
35937086 1.0 µg

Pafah2 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details