IFT81 Peptide - C-terminal region
IFT81 Peptide - C-terminal region
Product Specifications
UniProt
Q8WYA0
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with IFT81 Rabbit Polyclonal Antibody (orb589113) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001137251.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: IREQYTKNTAEQENLGKKLREKQKVIRESHGPNMKQAKMWRDLEQLMECK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Anti-Rhesus Monkey IgG [Clone 4D8.B10] - 100ug](https://cdn.genprice.uk/genprice/uk/genprice5.webp)
MBS6317060-01 0.1 mL
LRRC29, NT (LRRC29, FBL9, FBXL9, Leucine-rich repeat-containing protein 29, F-box and leucine-rich repeat protein 9, F-box protein FBL9, F-box/LRR-repeat protein 9) (MaxLight 490)
Sign In for Pricing
View Details MBS6317060-02 5x 0.1 mL
LRRC29, NT (LRRC29, FBL9, FBXL9, Leucine-rich repeat-containing protein 29, F-box and leucine-rich repeat protein 9, F-box protein FBL9, F-box/LRR-repeat protein 9) (MaxLight 490)
Sign In for Pricing
View Details