IFT81 Peptide - C-terminal region
IFT81 Peptide - C-terminal region
Product Specifications
UniProt
Q8WYA0
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with IFT81 Rabbit Polyclonal Antibody (orb589113) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001137251.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: IREQYTKNTAEQENLGKKLREKQKVIRESHGPNMKQAKMWRDLEQLMECK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PB9613-Fluoro550 100 µg/Vial
Anti-MICB Antibody Picoband® Fluoro550 Conjugated
Sign In for Pricing
View Details PAA30275-01 0.1 g
2,2-Bis (aminomethyl) propane-1,3-diamine tetrahydrochloride
Sign In for Pricing
View Details