Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNTTIP2 Peptide - C-terminal region

DNTTIP2 Peptide - C-terminal region

Product Specifications

UniProt

Q5QJE6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DNTTIP2 Rabbit Polyclonal Antibody (orb55771) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055412.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EMTNELKNDLKALKMRASMDPKRFYKKNDRDGFPKYFQIGTIVDNPADFY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD9 CRISPRa sgRNA lentivector (set of three targets)(Rat)
15580126 3x 1.0µg DNA

CD9 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Recombinant Rat Eotaxin/CCL11
P6924-500μg 500 µg

Recombinant Rat Eotaxin/CCL11

Sign In for Pricing
View Details
HDAC3 Antibody
MBS8512138-01 0.05 mg

HDAC3 Antibody

Sign In for Pricing
View Details
HDAC3 Antibody
MBS8512138-02 0.1 mg

HDAC3 Antibody

Sign In for Pricing
View Details
HDAC3 Antibody
MBS8512138-03 0.1 mL (AF750)

HDAC3 Antibody

Sign In for Pricing
View Details
HDAC3 Antibody
MBS8512138-04 0.1 mL (AF405M)

HDAC3 Antibody

Sign In for Pricing
View Details