RELL2 Peptide - middle region
RELL2 Peptide - middle region
Product Specifications
UniProt
Q8NC24
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RELL2 Rabbit Polyclonal Antibody (orb589140) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001123501.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RYGLHEHRDGSPTDRSWGSGGGQDPGGGQGSGGGQPKAGMPAMERLPPER
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
SL1147Mo-01 48 Tests
Mouse Receptor Interacting Serine Threonine Kinase 1 (RIPK1) ELISA Kit
Sign In for Pricing
View Details SL1147Mo-02 96 Tests
Mouse Receptor Interacting Serine Threonine Kinase 1 (RIPK1) ELISA Kit
Sign In for Pricing
View Details 263154-01 10 mg
3- (2-Bromoacetamido) -2,2,5,5-tetramethyl-1-pyrrolidinyloxy, free radical
Sign In for Pricing
View Details 263154-02 25 mg
3- (2-Bromoacetamido) -2,2,5,5-tetramethyl-1-pyrrolidinyloxy, free radical
Sign In for Pricing
View Details