Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RELL2 Peptide - middle region

RELL2 Peptide - middle region

Product Specifications

UniProt

Q8NC24

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RELL2 Rabbit Polyclonal Antibody (orb589140) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001123501.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RYGLHEHRDGSPTDRSWGSGGGQDPGGGQGSGGGQPKAGMPAMERLPPER

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hamster adiponectin, C1Q and collagen domain containing (ADIPOQ) ELISA kit
orb1671090 96 Tests

Hamster adiponectin, C1Q and collagen domain containing (ADIPOQ) ELISA kit

Sign In for Pricing
View Details
WNT8B Antibody Blocking peptide
orb1456594 500 µg

WNT8B Antibody Blocking peptide

Sign In for Pricing
View Details
Active Catalase (CAT)
MBS2125337-01 0.01 mg

Active Catalase (CAT)

Sign In for Pricing
View Details
Active Catalase (CAT)
MBS2125337-02 0.05 mg

Active Catalase (CAT)

Sign In for Pricing
View Details
Active Catalase (CAT)
MBS2125337-03 0.1 mg

Active Catalase (CAT)

Sign In for Pricing
View Details
Active Catalase (CAT)
MBS2125337-04 0.2 mg

Active Catalase (CAT)

Sign In for Pricing
View Details