Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZN519 Peptide - N-terminal region

ZN519 Peptide - N-terminal region

Product Specifications

Product Name Alternative

HsT2362

UniProt

Q8TB69

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZN519 Rabbit Polyclonal Antibody (orb55687) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_660330

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QGILPEQGIQDSFKKATLGRYGSCGLENICLWKNWESIGEGEGQKECYNL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hspa13 3'UTR Lenti-reporter-Luc Vector
23996084 1.0 µg

Hspa13 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Ppp3r2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
37492114 3x 1.0 µg

Ppp3r2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Phosphatase and actin regulator 4 (PHACTR4) Mouse ELISA Kit
F8253 96 Tests

Phosphatase and actin regulator 4 (PHACTR4) Mouse ELISA Kit

Sign In for Pricing
View Details
AKT1 + AKT2 Rabbit mAb
F2571-100uL*2 2x 100 μL

AKT1 + AKT2 Rabbit mAb

Sign In for Pricing
View Details
Recombinant Tropomyosin 3 (TPM3)
TRV-0010020-01 10 µg

Recombinant Tropomyosin 3 (TPM3)

Sign In for Pricing
View Details
Recombinant Tropomyosin 3 (TPM3)
TRV-0010020-02 50 µg

Recombinant Tropomyosin 3 (TPM3)

Sign In for Pricing
View Details