Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SYT12 Peptide - N-terminal region

SYT12 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SYT11, sytXII

UniProt

Q8IV01

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SYT12 Rabbit Polyclonal Antibody (orb584355) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001171351

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLGIAAVSLWKLWTSGSFPSPSPFPNYDYRYLQQKYGESCAEAREKRVPA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal Histone H2B [ac Lys5] Antibody (RM455) [Allophycocyanin]
NBP3-26034APC 0.1 mL

Rabbit Monoclonal Histone H2B [ac Lys5] Antibody (RM455) [Allophycocyanin]

Sign In for Pricing
View Details
Mouse MAP7D3 shRNA Plasmid
abx983469-01 150 µg

Mouse MAP7D3 shRNA Plasmid

Sign In for Pricing
View Details
Mouse MAP7D3 shRNA Plasmid
abx983469-02 300 µg

Mouse MAP7D3 shRNA Plasmid

Sign In for Pricing
View Details
Mouse gp130 DuoSet ELISA
DY468 15 Plates

Mouse gp130 DuoSet ELISA

Sign In for Pricing
View Details
HMGN4 antibody
70R-17764 50 μL

HMGN4 antibody

Sign In for Pricing
View Details
MAPKAPK5 AAV Vector (Rat) (CMV)
28080107 1 µg

MAPKAPK5 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details