Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SYT12 Peptide - N-terminal region

SYT12 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SYT11, sytXII

UniProt

Q8IV01

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SYT12 Rabbit Polyclonal Antibody (orb584355) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001171351

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLGIAAVSLWKLWTSGSFPSPSPFPNYDYRYLQQKYGESCAEAREKRVPA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-PER2 antibody
SL23388R-01 50 µL

Rabbit Anti-PER2 antibody

Sign In for Pricing
View Details
Rabbit Anti-PER2 antibody
SL23388R-02 100 µL

Rabbit Anti-PER2 antibody

Sign In for Pricing
View Details
Nitric Acid 4M (4N) Volumetric Solution in H2 O Nist Traceable
869500 1 L

Nitric Acid 4M (4N) Volumetric Solution in H2 O Nist Traceable

Sign In for Pricing
View Details
OR4A15 Peptide - N-terminal region
orb2004528 100 µg

OR4A15 Peptide - N-terminal region

Sign In for Pricing
View Details
Rabbit Polyclonal CRYL1 Antibody [FITC]
NBP3-06603F 0.1 mL

Rabbit Polyclonal CRYL1 Antibody [FITC]

Sign In for Pricing
View Details
PECI (ECI2) Mouse Monoclonal Antibody [Clone ID: OTI2H10]
TA504437 100 µL

PECI (ECI2) Mouse Monoclonal Antibody [Clone ID: OTI2H10]

Sign In for Pricing
View Details