OXYR Peptide - C-terminal region
OXYR Peptide - C-terminal region
Product Specifications
Product Name Alternative
OT-R
UniProt
B2R9L7
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with OXYR Rabbit Polyclonal Antibody (orb55707) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_000907
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LFTGHLFHELVQRFLCCSASYLKGRRLGETSASKKSNSSSFVLSHRSSSQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RDR-TGM1-Mu-01 96 Tests
Mouse Transglutaminase 1, Keratinocyte (TGM1) ELISA Kit
Sign In for Pricing
View Details RDR-TGM1-Mu-02 48 Tests
Mouse Transglutaminase 1, Keratinocyte (TGM1) ELISA Kit
Sign In for Pricing
View Details 
BNC400942-100 1x 100 µL
Milk Fat Globulin (EDM45), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details