Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OXYR Peptide - C-terminal region

OXYR Peptide - C-terminal region

Product Specifications

Product Name Alternative

OT-R

UniProt

B2R9L7

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OXYR Rabbit Polyclonal Antibody (orb55707) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000907

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LFTGHLFHELVQRFLCCSASYLKGRRLGETSASKKSNSSSFVLSHRSSSQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glutathione Reductase (GSR) (NM_000637) Human Recombinant Protein
TP309652M 100 µg

Glutathione Reductase (GSR) (NM_000637) Human Recombinant Protein

Sign In for Pricing
View Details
NADK (NM_001198994) Human Recombinant Protein
TP720242XL 1 mg

NADK (NM_001198994) Human Recombinant Protein

Sign In for Pricing
View Details
OR2AP1 Human Gene Knockout Kit (CRISPR)
KN432448 1 Kit

OR2AP1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
UBE2I (NM_194259) Human Recombinant Protein
TP317945M 100 µg

UBE2I (NM_194259) Human Recombinant Protein

Sign In for Pricing
View Details
Trypsin Activity Assay Kit
E-BC-K843-M-01 48 T (32 samples)

Trypsin Activity Assay Kit

Sign In for Pricing
View Details
Trypsin Activity Assay Kit
E-BC-K843-M-02 96 T (80 samples)

Trypsin Activity Assay Kit

Sign In for Pricing
View Details