Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BSND Peptide - middle region

BSND Peptide - middle region

Product Specifications

Product Name Alternative

BART, DFNB73

UniProt

Q8WZ55

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BSND Rabbit Polyclonal Antibody (orb584384) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_476517

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PGDVQAWMEAAVVIHKGSDESEGERRLTQSWPGPLACPQGPAPLASFQDD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Salmonella agona Dihydroxy-acid dehydratase (ilvD), partial
MBS1178902 Inquire

Recombinant Salmonella agona Dihydroxy-acid dehydratase (ilvD), partial

Sign In for Pricing
View Details
RIPK3 Peptide
DF7339-BP 1 mg

RIPK3 Peptide

Sign In for Pricing
View Details
Tbc1d7 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
46266116 3x 1.0 µg

Tbc1d7 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
GENLISA™ Human FK506 Binding Protein 1A (FKBP1A) ELISA
KBH5844 1x 96 Well

GENLISA™ Human FK506 Binding Protein 1A (FKBP1A) ELISA

Sign In for Pricing
View Details
FAM114A2 Protein Vector (Mouse) (pPM-C-HA)
19721024 500 ng

FAM114A2 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Salbutamon-d9 hydrochloride
sc-472994 1 mg

Salbutamon-d9 hydrochloride

Sign In for Pricing
View Details