Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRK Peptide - middle region

CRK Peptide - middle region

Product Specifications

Product Name Alternative

P38, CRKII

UniProt

P46108

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CRK Rabbit Polyclonal Antibody (orb588238) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005197.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLPN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ammonium molybdate tetrahydrate - ACS
FA30568-01 250 g

Ammonium molybdate tetrahydrate - ACS

Sign In for Pricing
View Details
Ammonium molybdate tetrahydrate - ACS
FA30568-02 500 g

Ammonium molybdate tetrahydrate - ACS

Sign In for Pricing
View Details
Ammonium molybdate tetrahydrate - ACS
FA30568-03 1000 g

Ammonium molybdate tetrahydrate - ACS

Sign In for Pricing
View Details
Ammonium molybdate tetrahydrate - ACS
FA30568-04 2000 g

Ammonium molybdate tetrahydrate - ACS

Sign In for Pricing
View Details
Ammonium molybdate tetrahydrate - ACS
FA30568-05 5000 g

Ammonium molybdate tetrahydrate - ACS

Sign In for Pricing
View Details
mmu-miR-6907-3p miRNA Antagomir
MBS8319811-01 10 nmol

mmu-miR-6907-3p miRNA Antagomir

Sign In for Pricing
View Details