PDE8B Peptide - middle region
PDE8B Peptide - middle region
Product Specifications
Product Name Alternative
ADSD, PPNAD3
UniProt
B3KN77
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PDE8B Rabbit Polyclonal Antibody (orb588328) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001025022.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GQGGKIRHFVSLKKLCCTTDNNKQIHKIHRDSGDNSQTEPHSFRYKNRRK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1289890-01 0.02 mg (E-Coli)
Recombinant Staphylococcus epidermidis Lysine--tRNA ligase (lysS)
Sign In for Pricing
View Details MBS1289890-02 0.02 mg (Yeast)
Recombinant Staphylococcus epidermidis Lysine--tRNA ligase (lysS)
Sign In for Pricing
View Details MBS1289890-03 0.1 mg (E-Coli)
Recombinant Staphylococcus epidermidis Lysine--tRNA ligase (lysS)
Sign In for Pricing
View Details MBS1289890-04 0.1 mg (Yeast)
Recombinant Staphylococcus epidermidis Lysine--tRNA ligase (lysS)
Sign In for Pricing
View Details MBS1289890-05 0.02 mg (Baculovirus)
Recombinant Staphylococcus epidermidis Lysine--tRNA ligase (lysS)
Sign In for Pricing
View Details MBS1289890-06 0.02 mg (Mammalian-Cell)
Recombinant Staphylococcus epidermidis Lysine--tRNA ligase (lysS)
Sign In for Pricing
View Details