Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDE8B Peptide - middle region

PDE8B Peptide - middle region

Product Specifications

Product Name Alternative

ADSD, PPNAD3

UniProt

B3KN77

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PDE8B Rabbit Polyclonal Antibody (orb588328) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001025022.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GQGGKIRHFVSLKKLCCTTDNNKQIHKIHRDSGDNSQTEPHSFRYKNRRK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AdmiRa-rno-miR-764-5p-Off Virus
mr5633 1.0 mL

AdmiRa-rno-miR-764-5p-Off Virus

Sign In for Pricing
View Details
POLR3B Rabbit Polyclonal Antibody
orb580533 100 µL

POLR3B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Vmn2r110 Protein Vector (Mouse) (pPB-C-His)
PV246022 500 ng

Vmn2r110 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
MLK2/MAP3K10 Rabbit Polyclonal Antibody (Biotin)
orb451547 100 µL

MLK2/MAP3K10 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Rat PINP (Procollagen I N-Terminal Propeptide) Microsample ELISA Kit
orb2997568-01 48 Tests

Rat PINP (Procollagen I N-Terminal Propeptide) Microsample ELISA Kit

Sign In for Pricing
View Details
Rat PINP (Procollagen I N-Terminal Propeptide) Microsample ELISA Kit
orb2997568-02 96 Tests

Rat PINP (Procollagen I N-Terminal Propeptide) Microsample ELISA Kit

Sign In for Pricing
View Details