Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BAHD1 Peptide - middle region

BAHD1 Peptide - middle region

Product Specifications

UniProt

Q8TBE0

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BAHD1 Rabbit Polyclonal Antibody (orb589128) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001288061.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TARSKAARRPSHPKQPRVQRPRPRRRRRRRTNGWVPVGAACEKAVYVLDE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL33 siRNA (Human)
orb1854265-01 15 nmol

IL33 siRNA (Human)

Sign In for Pricing
View Details
IL33 siRNA (Human)
orb1854265-02 30 nmol

IL33 siRNA (Human)

Sign In for Pricing
View Details
Canine 3-ketoacyl-CoA thiolase, mitochondrial (ACAA2) ELISA Kit
MBS7201934-01 48 Well

Canine 3-ketoacyl-CoA thiolase, mitochondrial (ACAA2) ELISA Kit

Sign In for Pricing
View Details
Canine 3-ketoacyl-CoA thiolase, mitochondrial (ACAA2) ELISA Kit
MBS7201934-02 96 Well

Canine 3-ketoacyl-CoA thiolase, mitochondrial (ACAA2) ELISA Kit

Sign In for Pricing
View Details
Canine 3-ketoacyl-CoA thiolase, mitochondrial (ACAA2) ELISA Kit
MBS7201934-03 5x 96 Well

Canine 3-ketoacyl-CoA thiolase, mitochondrial (ACAA2) ELISA Kit

Sign In for Pricing
View Details
Canine 3-ketoacyl-CoA thiolase, mitochondrial (ACAA2) ELISA Kit
MBS7201934-04 10x 96 Well

Canine 3-ketoacyl-CoA thiolase, mitochondrial (ACAA2) ELISA Kit

Sign In for Pricing
View Details