BAHD1 Peptide - middle region
BAHD1 Peptide - middle region
Product Specifications
UniProt
Q8TBE0
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with BAHD1 Rabbit Polyclonal Antibody (orb589128) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001288061.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TARSKAARRPSHPKQPRVQRPRPRRRRRRRTNGWVPVGAACEKAVYVLDE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15379130 1 Vial
Lentiviral human ARVCF sgRNA gene knockout kit - Lentiviral human ARVCF sgRNA gene knockout kit (plasmid)
Sign In for Pricing
View Details 
249567-ML650 100 µL
NXF2 (Nuclear RNA export Factor 2, FLJ20416, TAPL-2) (MaxLight 650)
Sign In for Pricing
View Details