Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STK36 Peptide - middle region

STK36 Peptide - middle region

Product Specifications

Product Name Alternative

FU

UniProt

H7C2I3

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with STK36 Rabbit Polyclonal Antibody (orb589160) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001230242.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PRENRTTPDCERAFPEERPEVLGQRSTDVVDLENEEPDSDNEWQHLLETT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Protein DEK (DEK) ELISA Kit
MBS9918690-01 48 Well

Rat Protein DEK (DEK) ELISA Kit

Sign In for Pricing
View Details
Rat Protein DEK (DEK) ELISA Kit
MBS9918690-02 96 Well

Rat Protein DEK (DEK) ELISA Kit

Sign In for Pricing
View Details
Rat Protein DEK (DEK) ELISA Kit
MBS9918690-03 5x 96 Well

Rat Protein DEK (DEK) ELISA Kit

Sign In for Pricing
View Details
Rat Protein DEK (DEK) ELISA Kit
MBS9918690-04 10x 96 Well

Rat Protein DEK (DEK) ELISA Kit

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Talin (TLN)
MBS2040441-01 0.1 mL

APC-Linked Polyclonal Antibody to Talin (TLN)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Talin (TLN)
MBS2040441-02 0.2 mL

APC-Linked Polyclonal Antibody to Talin (TLN)

Sign In for Pricing
View Details