Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RILPL2 Peptide - middle region

RILPL2 Peptide - middle region

Product Specifications

Product Name Alternative

RLP2

UniProt

Q5EBL4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RILPL2 Rabbit Polyclonal Antibody (orb589161) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_659495.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RKEVEGLRRQSPPASGEVNLGPNKMVVDLTDPNRPRFTLQELRDVLQERN

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human POM121L2 shRNA Plasmid
abx964236-01 150 µg

Human POM121L2 shRNA Plasmid

Sign In for Pricing
View Details
Human POM121L2 shRNA Plasmid
abx964236-02 300 µg

Human POM121L2 shRNA Plasmid

Sign In for Pricing
View Details
HOXB13 (FITC)
564984-01 50 µg

HOXB13 (FITC)

Sign In for Pricing
View Details
HOXB13 (FITC)
564984-02 100 µg

HOXB13 (FITC)

Sign In for Pricing
View Details
Olfr1226 (NM_146967) Mouse Tagged ORF Clone Lentiviral Particle
MR214487L4V 200 µL

Olfr1226 (NM_146967) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Mouse Zinc finger protein 692 (ZNF692) ELISA Kit
abx554923 96 Tests

Mouse Zinc finger protein 692 (ZNF692) ELISA Kit

Sign In for Pricing
View Details