RILPL2 Peptide - middle region
RILPL2 Peptide - middle region
Product Specifications
Product Name Alternative
RLP2
UniProt
Q5EBL4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RILPL2 Rabbit Polyclonal Antibody (orb589161) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_659495.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RKEVEGLRRQSPPASGEVNLGPNKMVVDLTDPNRPRFTLQELRDVLQERN
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2075842-01 0.1 mL
APC/CY7-Linked Polyclonal Antibody to Sirtuin 6 (SIRT6)
Sign In for Pricing
View Details MBS2075842-02 0.2 mL
APC/CY7-Linked Polyclonal Antibody to Sirtuin 6 (SIRT6)
Sign In for Pricing
View Details MBS2075842-03 0.5 mL
APC/CY7-Linked Polyclonal Antibody to Sirtuin 6 (SIRT6)
Sign In for Pricing
View Details MBS2075842-04 1 mL
APC/CY7-Linked Polyclonal Antibody to Sirtuin 6 (SIRT6)
Sign In for Pricing
View Details MBS2075842-05 5 mL
APC/CY7-Linked Polyclonal Antibody to Sirtuin 6 (SIRT6)
Sign In for Pricing
View Details