Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD19 Peptide - C-terminal region

CD19 Peptide - C-terminal region

Product Specifications

Product Name Alternative

B4, CVID3

UniProt

P15391

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD19 Rabbit Polyclonal Antibody (orb589164) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001171569.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RGILYAAPQLRSIRGQPGPNHEEDADSYENMDNPDGPDPAWGGGGRMGTW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Z-Cys(Trt)-OH
5-07227 25 g

Z-Cys(Trt)-OH

Sign In for Pricing
View Details
AATC Polyclonal Antibody
UB-GEN-10659 100 µL

AATC Polyclonal Antibody

Sign In for Pricing
View Details
PCMV-ITCH-3xMyc-Neo Plasmid
PVT83727 2 µg

PCMV-ITCH-3xMyc-Neo Plasmid

Sign In for Pricing
View Details
EIF4E discontinued
388650 200 µL

EIF4E discontinued

Sign In for Pricing
View Details
FOXO1 polyclonal antibody
orb1716436-01 50 µL

FOXO1 polyclonal antibody

Sign In for Pricing
View Details
FOXO1 polyclonal antibody
orb1716436-02 100 µL

FOXO1 polyclonal antibody

Sign In for Pricing
View Details