Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD19 Peptide - C-terminal region

CD19 Peptide - C-terminal region

Product Specifications

Product Name Alternative

B4, CVID3

UniProt

P15391

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD19 Rabbit Polyclonal Antibody (orb589164) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001171569.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RGILYAAPQLRSIRGQPGPNHEEDADSYENMDNPDGPDPAWGGGGRMGTW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNAH3 Polyclonal Antibody, FITC Conjugated
A56889-050 50 µL

DNAH3 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
c-Jun (JUN) pThr91 Rabbit Polyclonal Antibody
AP02322PU-N 100 µL

c-Jun (JUN) pThr91 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Transforming Growth Factor Beta Induced Protein (TGFbI)
TRV-0007261-01 10 µg

Recombinant Transforming Growth Factor Beta Induced Protein (TGFbI)

Sign In for Pricing
View Details
Recombinant Transforming Growth Factor Beta Induced Protein (TGFbI)
TRV-0007261-02 50 µg

Recombinant Transforming Growth Factor Beta Induced Protein (TGFbI)

Sign In for Pricing
View Details
Recombinant Transforming Growth Factor Beta Induced Protein (TGFbI)
TRV-0007261-03 100 µg

Recombinant Transforming Growth Factor Beta Induced Protein (TGFbI)

Sign In for Pricing
View Details
Recombinant Transforming Growth Factor Beta Induced Protein (TGFbI)
TRV-0007261-04 200 µg

Recombinant Transforming Growth Factor Beta Induced Protein (TGFbI)

Sign In for Pricing
View Details