NAA60 Peptide - middle region
NAA60 Peptide - middle region
Product Specifications
Product Name Alternative
HAT4, NatF, NAT15, hNaa60
UniProt
Q9H7X0
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with NAA60 Rabbit Polyclonal Antibody (orb55789) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001077069.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: IDTVKHLCGDWFPIEYPDSWYRDITSNKKFFSLAATYRGAIVGMIVAEIK
More Discoveries
Explore Other Products
Browse additional items from our catalog
213497-01 20 µL
SND1 (Staphylococcal Nuclease Domain-containing Protein 1, p100, TDRD11) discontinued
Sign In for Pricing
View Details 
213497-02 100 µL
SND1 (Staphylococcal Nuclease Domain-containing Protein 1, p100, TDRD11) discontinued
Sign In for Pricing
View Details 
RC202723 10 µg
Apolipoprotein A II (APOA2) (NM_001643) Human Tagged ORF Clone
Sign In for Pricing
View Details 