Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NAA60 Peptide - middle region

NAA60 Peptide - middle region

Product Specifications

Product Name Alternative

HAT4, NatF, NAT15, hNaa60

UniProt

Q9H7X0

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NAA60 Rabbit Polyclonal Antibody (orb55789) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001077069.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IDTVKHLCGDWFPIEYPDSWYRDITSNKKFFSLAATYRGAIVGMIVAEIK

More Discoveries

Explore Other Products

Browse additional items from our catalog

Smgc Rat shRNA Lentiviral Particle (Locus ID 446171)
TL700633V 500 µL Each

Smgc Rat shRNA Lentiviral Particle (Locus ID 446171)

Sign In for Pricing
View Details
ERDRP-0519
MBS5773796 Inquire

ERDRP-0519

Sign In for Pricing
View Details
L3MBTL2 Recombinant Protein (Human)
RP017449 100 µg

L3MBTL2 Recombinant Protein (Human)

Sign In for Pricing
View Details
Lentiviral human POMP shRNA (UAS) - Lentiviral human POMP shRNA (UAS) plasmid
GTR15124111 1 Vial

Lentiviral human POMP shRNA (UAS) - Lentiviral human POMP shRNA (UAS) plasmid

Sign In for Pricing
View Details
Mmu-miR-8105 miRNA Agomir
orb1917090-01 5 nmol

Mmu-miR-8105 miRNA Agomir

Sign In for Pricing
View Details
Mmu-miR-8105 miRNA Agomir
orb1917090-02 10 nmol

Mmu-miR-8105 miRNA Agomir

Sign In for Pricing
View Details