Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AMY2A Peptide - C-terminal region

AMY2A Peptide - C-terminal region

Product Specifications

Product Name Alternative

PA, AMY2

UniProt

Q6NSB3

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AMY2A Rabbit Polyclonal Antibody (orb589226) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000690.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Iron (II) sulfate, heptahydrate
FB0461 500g

Iron (II) sulfate, heptahydrate

Sign In for Pricing
View Details
SIX6 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
43821156 3x 1.0 µg DNA

SIX6 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
Mizf (BC029091) Mouse Tagged ORF Clone
MG208084 10 µg

Mizf (BC029091) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Chrysophanic acid
268572-01 500 mg

Chrysophanic acid

Sign In for Pricing
View Details
Chrysophanic acid
268572-02 1 g

Chrysophanic acid

Sign In for Pricing
View Details
Chrysophanic acid
268572-03 2 g

Chrysophanic acid

Sign In for Pricing
View Details