Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AMY2A Peptide - C-terminal region

AMY2A Peptide - C-terminal region

Product Specifications

Product Name Alternative

PA, AMY2

UniProt

Q6NSB3

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AMY2A Rabbit Polyclonal Antibody (orb589226) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000690.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFI27L2 (NM_032036) Human Recombinant Protein
E45H32271E1 50 µg

IFI27L2 (NM_032036) Human Recombinant Protein

Sign In for Pricing
View Details
mouse Monoclonal ARG2 Antibody (7F8)
NBP2-59406-100ul 100 µL

mouse Monoclonal ARG2 Antibody (7F8)

Sign In for Pricing
View Details
Mouse Extracellular calcium-sensing receptor (CASR) ELISA Kit
RK08265 96 Tests

Mouse Extracellular calcium-sensing receptor (CASR) ELISA Kit

Sign In for Pricing
View Details
Phaseolus vulgaris Lectin (PHA-E) - Ferritin
30330019-1 1 mg

Phaseolus vulgaris Lectin (PHA-E) - Ferritin

Sign In for Pricing
View Details
Core (HCV/Genotype-1b)
IT-004-057Ep-01 0.1 mg

Core (HCV/Genotype-1b)

Sign In for Pricing
View Details
Core (HCV/Genotype-1b)
IT-004-057Ep-02 1 mg

Core (HCV/Genotype-1b)

Sign In for Pricing
View Details