KLK11 Peptide - middle region
KLK11 Peptide - middle region
Product Specifications
Product Name Alternative
TLSP, PRSS20
UniProt
Q9UBX7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with KLK11 Rabbit Polyclonal Antibody (orb589227) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001129504.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NLQKEEGCEQTRTATESFPHPGFNNSLPNKDHRNDIMLVKMASPVSITWA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
E2237-01C 100 µg
EIF2S1 (Eukaryotic Translation Initiation Factor 2, Subunit 1 alpha, eIF2 alpha, eIF-2-alpha, eIF-2A, eIF-2alpha, EIF2A, Eukaryotic Translation Initiation Factor 2 Subunit 1) discontinued
Sign In for Pricing
View Details 
H5243 96 Tests
Testosterone 17-β-Dehydrogenase 3 (HSD17B3) Rat ELISA Kit
Sign In for Pricing
View Details 
D2227 96 Tests
Epithelial splicing regulatory protein 1 (ESRP1) Mouse ELISA Kit
Sign In for Pricing
View Details