Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLK11 Peptide - middle region

KLK11 Peptide - middle region

Product Specifications

Product Name Alternative

TLSP, PRSS20

UniProt

Q9UBX7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KLK11 Rabbit Polyclonal Antibody (orb589227) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001129504.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NLQKEEGCEQTRTATESFPHPGFNNSLPNKDHRNDIMLVKMASPVSITWA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(-)-Tabersonine
TRC-T003900-25MG 25 mg

(-)-Tabersonine

Sign In for Pricing
View Details
Amidosulfonic Acid
TRC-A576785-1G 1 g

Amidosulfonic Acid

Sign In for Pricing
View Details
OR1B1 (NM_001004450) Human Over-expression Lysate
LC423755 20 µg

OR1B1 (NM_001004450) Human Over-expression Lysate

Sign In for Pricing
View Details
DuLLARD (CTDNEP1) (NM_015343) Human Over-expression Lysate
LY402423 100 µg

DuLLARD (CTDNEP1) (NM_015343) Human Over-expression Lysate

Sign In for Pricing
View Details
UBF1 (UBTF) (NM_001076683) Human Over-expression Lysate
LC421360 20 µg

UBF1 (UBTF) (NM_001076683) Human Over-expression Lysate

Sign In for Pricing
View Details
Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1387), Biotin conjugate, 0.1mg/mL
BNCB1387-500 1x 500 µL

Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1387), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details