MIA Peptide - middle region
MIA Peptide - middle region
Product Specifications
Product Name Alternative
CD-RAP
UniProt
A0A024R0P1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MIA Rabbit Polyclonal Antibody (orb589228) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001189482.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AVALQDYMAPDCRFLTIHRGQVVYVFSKLKGRGRLFWGGSVQGDYYGDLA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1135395-01 0.02 mg (E-Coli)
Recombinant Escherichia coli O7:K1 Ribosome maturation factor RimP (rimP)
Sign In for Pricing
View Details MBS1135395-02 0.1 mg (E-Coli)
Recombinant Escherichia coli O7:K1 Ribosome maturation factor RimP (rimP)
Sign In for Pricing
View Details MBS1135395-03 0.02 mg (Yeast)
Recombinant Escherichia coli O7:K1 Ribosome maturation factor RimP (rimP)
Sign In for Pricing
View Details MBS1135395-04 0.1 mg (Yeast)
Recombinant Escherichia coli O7:K1 Ribosome maturation factor RimP (rimP)
Sign In for Pricing
View Details MBS1135395-05 0.02 mg (Baculovirus)
Recombinant Escherichia coli O7:K1 Ribosome maturation factor RimP (rimP)
Sign In for Pricing
View Details