Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCR1 Peptide - middle region

CCR1 Peptide - middle region

Product Specifications

Product Name Alternative

CKR1, CD191, CKR-1, HM145, CMKBR1, MIP1aR, SCYAR1

UniProt

Q5U003

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCR1 Rabbit Polyclonal Antibody (orb589229) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001286.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ISDLLFLFTLPFWIDYKLKDDWVFGDAMCKILSGFYYTGLYSEIFFIILL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WIPI1 (NM_017983) Human Over-expression Lysate
LS055062 100 µg

WIPI1 (NM_017983) Human Over-expression Lysate

Sign In for Pricing
View Details
TRNAK12 3'UTR Luciferase Stable Cell Line
TU026869 1.0 mL

TRNAK12 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Propyl dodecanoate
HY-W002270-01 10 g

Propyl dodecanoate

Sign In for Pricing
View Details
Propyl dodecanoate
HY-W002270-02 25 g

Propyl dodecanoate

Sign In for Pricing
View Details
Propyl dodecanoate
HY-W002270-03 50 g

Propyl dodecanoate

Sign In for Pricing
View Details
Propyl dodecanoate
HY-W002270-04 100 g

Propyl dodecanoate

Sign In for Pricing
View Details