Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATAD3B Peptide - N-terminal region

ATAD3B Peptide - N-terminal region

Product Specifications

Product Name Alternative

TOB3, AAA-TOB3

UniProt

Q9NVI7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ATAD3B Rabbit Polyclonal Antibody (orb589232) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_114127.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LPPAQPGAEGGGDRGLGDRPAPKDKWSNFDPTGLERAAKAARELEHSRYA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-phospho-beta Adducin (Ser713) antibody
SL12960R-01 50 µL

Rabbit Anti-phospho-beta Adducin (Ser713) antibody

Sign In for Pricing
View Details
Rabbit Anti-phospho-beta Adducin (Ser713) antibody
SL12960R-02 100 µL

Rabbit Anti-phospho-beta Adducin (Ser713) antibody

Sign In for Pricing
View Details
TP53I13 Rabbit Polyclonal Antibody (Cy7)
orb1042180 100 µL

TP53I13 Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
Stearic anhydride
sc-215904 50 g

Stearic anhydride

Sign In for Pricing
View Details
Bovine anti PL12 antibody, PL12/AlaRS ELISA kit
GTR10453890 96 Well

Bovine anti PL12 antibody, PL12/AlaRS ELISA kit

Sign In for Pricing
View Details
Chemokine C-C-Motif Ligand 14 (CCL14) Antibody
abx128557-01 100 µL

Chemokine C-C-Motif Ligand 14 (CCL14) Antibody

Sign In for Pricing
View Details