Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATAD3B Peptide - N-terminal region

ATAD3B Peptide - N-terminal region

Product Specifications

Product Name Alternative

TOB3, AAA-TOB3

UniProt

Q9NVI7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ATAD3B Rabbit Polyclonal Antibody (orb589232) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_114127.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LPPAQPGAEGGGDRGLGDRPAPKDKWSNFDPTGLERAAKAARELEHSRYA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OLFR818 Adenovirus (Mouse)
33469054 1.0 mL

OLFR818 Adenovirus (Mouse)

Sign In for Pricing
View Details
Fanci sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4720203 1.0 µg DNA

Fanci sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Adcy2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4082806 1.0 µg DNA

Adcy2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Interleukin 4 (IL4), Recombinant, Mouse, His-Tag, GST-Tag
053871-01 10 µg

Interleukin 4 (IL4), Recombinant, Mouse, His-Tag, GST-Tag

Sign In for Pricing
View Details
Interleukin 4 (IL4), Recombinant, Mouse, His-Tag, GST-Tag
053871-02 50 µg

Interleukin 4 (IL4), Recombinant, Mouse, His-Tag, GST-Tag

Sign In for Pricing
View Details
Interleukin 4 (IL4), Recombinant, Mouse, His-Tag, GST-Tag
053871-03 100 µg

Interleukin 4 (IL4), Recombinant, Mouse, His-Tag, GST-Tag

Sign In for Pricing
View Details