Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RRAGD Peptide - N-terminal region

RRAGD Peptide - N-terminal region

Product Specifications

Product Name Alternative

RAGD, bA11D8.2.1

UniProt

Q9NQL2

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RRAGD Rabbit Polyclonal Antibody (orb583604) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_067067.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PQPQDEDDAEEEEEEDELVGLADYGDGPDSSDADPDSGTEEGVLDFSDPF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat HTR2C (5-Hydroxytryptamine Receptor 2C) ELISA Kit
MBS8805199-01 48 Well

Rat HTR2C (5-Hydroxytryptamine Receptor 2C) ELISA Kit

Sign In for Pricing
View Details
Rat HTR2C (5-Hydroxytryptamine Receptor 2C) ELISA Kit
MBS8805199-02 96 Well

Rat HTR2C (5-Hydroxytryptamine Receptor 2C) ELISA Kit

Sign In for Pricing
View Details
Rat HTR2C (5-Hydroxytryptamine Receptor 2C) ELISA Kit
MBS8805199-03 5x 96 Well

Rat HTR2C (5-Hydroxytryptamine Receptor 2C) ELISA Kit

Sign In for Pricing
View Details
Rat HTR2C (5-Hydroxytryptamine Receptor 2C) ELISA Kit
MBS8805199-04 10x 96 Well

Rat HTR2C (5-Hydroxytryptamine Receptor 2C) ELISA Kit

Sign In for Pricing
View Details
MAT IIβ Lentiviral Activation Particles (m)
sc-430833-LAC 200 µL

MAT IIβ Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
Recombinant Transient Receptor Potential Cation Channel Subfamily M, Member 4 (TRPM4)
TRV-0013505-01 10 µg

Recombinant Transient Receptor Potential Cation Channel Subfamily M, Member 4 (TRPM4)

Sign In for Pricing
View Details