Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RRAGD Peptide - N-terminal region

RRAGD Peptide - N-terminal region

Product Specifications

Product Name Alternative

RAGD, bA11D8.2.1

UniProt

Q9NQL2

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RRAGD Rabbit Polyclonal Antibody (orb583604) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_067067.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PQPQDEDDAEEEEEEDELVGLADYGDGPDSSDADPDSGTEEGVLDFSDPF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ß-D-Glucose Pentaacetate extrapure, 99%
65776-01 25 g

ß-D-Glucose Pentaacetate extrapure, 99%

Sign In for Pricing
View Details
ß-D-Glucose Pentaacetate extrapure, 99%
65776-02 100 g

ß-D-Glucose Pentaacetate extrapure, 99%

Sign In for Pricing
View Details
1-Butyl-5- (morpholine-4-sulfonyl) -1H-benzoimidazole-2-thiol
sc-333836 250 mg

1-Butyl-5- (morpholine-4-sulfonyl) -1H-benzoimidazole-2-thiol

Sign In for Pricing
View Details
Polyporoid B
orb1943338 5 mg

Polyporoid B

Sign In for Pricing
View Details
MAPRE1 Rabbit Polyclonal Antibody (APC-Cy7)
orb2477639 100 µL

MAPRE1 Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
HDHD3 (NM_031219) Human Untagged Clone
SC108724 10 µg

HDHD3 (NM_031219) Human Untagged Clone

Sign In for Pricing
View Details