OR2C3 Peptide - C-terminal region
OR2C3 Peptide - C-terminal region
Product Specifications
Product Name Alternative
OR2C4, OR2C5P, OST742
UniProt
Q8N628
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with OR2C3 Rabbit Polyclonal Antibody (orb584424) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_932340
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LQPAKSTSHEQGKFIALFYTVVTPALNPLIYTLRNTEVKSALRHMVLENC
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS7237869-01 48 Well
Rabbit NADPH--cytochrome P450 reductase (POR) ELISA Kit
Sign In for Pricing
View Details MBS7237869-02 96 Well
Rabbit NADPH--cytochrome P450 reductase (POR) ELISA Kit
Sign In for Pricing
View Details MBS7237869-03 5x 96 Well
Rabbit NADPH--cytochrome P450 reductase (POR) ELISA Kit
Sign In for Pricing
View Details MBS7237869-04 10x 96 Well
Rabbit NADPH--cytochrome P450 reductase (POR) ELISA Kit
Sign In for Pricing
View Details