Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR2C3 Peptide - C-terminal region

OR2C3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR2C4, OR2C5P, OST742

UniProt

Q8N628

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR2C3 Rabbit Polyclonal Antibody (orb584424) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_932340

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LQPAKSTSHEQGKFIALFYTVVTPALNPLIYTLRNTEVKSALRHMVLENC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COPZ1 Rabbit Polyclonal Antibody (BF594)
orb2519334 100 µL

COPZ1 Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
UNC50 Polyclonal Antibody
MBS2574124-01 0.06 mL

UNC50 Polyclonal Antibody

Sign In for Pricing
View Details
UNC50 Polyclonal Antibody
MBS2574124-02 0.12 mL

UNC50 Polyclonal Antibody

Sign In for Pricing
View Details
UNC50 Polyclonal Antibody
MBS2574124-03 0.2 mL

UNC50 Polyclonal Antibody

Sign In for Pricing
View Details
UNC50 Polyclonal Antibody
MBS2574124-04 5x 0.2 mL

UNC50 Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-Bcr (Tyr177) Blocking Peptide
MBS9615509-01 1 mg

Phospho-Bcr (Tyr177) Blocking Peptide

Sign In for Pricing
View Details