OR2G2 Peptide - C-terminal region
OR2G2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
OR1-32
UniProt
Q8NGZ5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with OR2G2 Rabbit Polyclonal Antibody (orb584426) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001001915
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VTIFYGTIIFMYLQPAKSRSRDQGKFVSLFYTVVTRMLNPLIYTLRIKEV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
C2081-30B-ML650 100 µL
CASC3 (Y181) (Cancer Susceptibility Candidate Gene 3 Protein Homolog, Metastatic Lymph Node Protein 51 Homolog, Protein MLN 51 Homolog, Protein Barentsz, Btz, mBtz, Protein CASC3, Mln51) (MaxLight 650) discontinued
Sign In for Pricing
View Details CSB-EP005898HU1-01 10 µg
Recombinant Human Carboxypeptidase N catalytic chain (CPN1), partial
Sign In for Pricing
View Details CSB-EP005898HU1-02 50 µg
Recombinant Human Carboxypeptidase N catalytic chain (CPN1), partial
Sign In for Pricing
View Details CSB-EP005898HU1-03 200 µg
Recombinant Human Carboxypeptidase N catalytic chain (CPN1), partial
Sign In for Pricing
View Details