Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR2G2 Peptide - C-terminal region

OR2G2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR1-32

UniProt

Q8NGZ5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR2G2 Rabbit Polyclonal Antibody (orb584426) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001001915

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VTIFYGTIIFMYLQPAKSRSRDQGKFVSLFYTVVTRMLNPLIYTLRIKEV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Skeletalmuscle Antibody ELISA Kit
MBS016981-01 48 Well

Rat Skeletalmuscle Antibody ELISA Kit

Sign In for Pricing
View Details
Rat Skeletalmuscle Antibody ELISA Kit
MBS016981-02 96 Well

Rat Skeletalmuscle Antibody ELISA Kit

Sign In for Pricing
View Details
Rat Skeletalmuscle Antibody ELISA Kit
MBS016981-03 5x 96 Well

Rat Skeletalmuscle Antibody ELISA Kit

Sign In for Pricing
View Details
Rat Skeletalmuscle Antibody ELISA Kit
MBS016981-04 10x 96 Well

Rat Skeletalmuscle Antibody ELISA Kit

Sign In for Pricing
View Details
EMD Recombinant Monoclonal Antibody
CSB-RA268144A0HU-01 50 μL

EMD Recombinant Monoclonal Antibody

Sign In for Pricing
View Details
EMD Recombinant Monoclonal Antibody
CSB-RA268144A0HU-02 100 µL

EMD Recombinant Monoclonal Antibody

Sign In for Pricing
View Details