Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABLM1 Peptide - C-terminal region

ABLM1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ABLIM, LIMAB1, LIMATIN, abLIM-1

UniProt

O14639

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ABLM1 Rabbit Polyclonal Antibody (orb584447) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001003407

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TPKIETDHWPGPPSFAVVGPDMKRRSSGREEDDEELLRRRQLQEEQLMKL

More Discoveries

Explore Other Products

Browse additional items from our catalog

3L PC Wide-mouth High Efficient Erlenmeyer Flasks, Flat Base, Vent Filter Cap, Sterile, 1/pk, 4/cs
CS0012-786511 1 Each

3L PC Wide-mouth High Efficient Erlenmeyer Flasks, Flat Base, Vent Filter Cap, Sterile, 1/pk, 4/cs

Sign In for Pricing
View Details
AGGF1P3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV718367 1.0 µg DNA

AGGF1P3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
C1orf167 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
14158111 3x 1.0 µg

C1orf167 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Mouse MEA-1 Affinity Purified Polyclonal Ab
AF3088-SP 25 µg

Mouse MEA-1 Affinity Purified Polyclonal Ab

Sign In for Pricing
View Details
LYPLAL1 Lentiviral Activation Particles (h2)
sc-414290-LAC-2 200 µL

LYPLAL1 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
Rabbit Monoclonal Ki-67/MKI67 Antibody (1297A) [Alexa Fluor 647]
NBP2-54791AF647 0.1 mL

Rabbit Monoclonal Ki-67/MKI67 Antibody (1297A) [Alexa Fluor 647]

Sign In for Pricing
View Details