Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OPN5 Peptide - C-terminal region

OPN5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PGR12, GPR136, GRP136, TMEM13

UniProt

Q6U736

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OPN5 Rabbit Polyclonal Antibody (orb584473) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_859528

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YNPIIYQVIDYKFACCQTGGLKATKKKSLEGFRLHTVTTVRKSSAVLEIH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Magic™ Membrane Protein Human OR6C68 (Olfactory receptor family 6 subfamily C member 68) Full Length
MPC3345K Each

Magic™ Membrane Protein Human OR6C68 (Olfactory receptor family 6 subfamily C member 68) Full Length

Sign In for Pricing
View Details
Ift57 3'UTR Lenti-reporter-Luc Vector
24294086 1.0 µg

Ift57 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
CD26 Rabbit Polyclonal Antibody (RBITC)
orb1049720 100 µL

CD26 Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details
Amy2a3 Recombinant Protein (Mouse)
RP115661 100 µg

Amy2a3 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
LUM/Lumican Mouse Monoclonal Antibody
orb2957175-01 50 µg

LUM/Lumican Mouse Monoclonal Antibody

Sign In for Pricing
View Details
LUM/Lumican Mouse Monoclonal Antibody
orb2957175-02 100 µg

LUM/Lumican Mouse Monoclonal Antibody

Sign In for Pricing
View Details