Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OPN5 Peptide - C-terminal region

OPN5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PGR12, GPR136, GRP136, TMEM13

UniProt

Q6U736

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OPN5 Rabbit Polyclonal Antibody (orb584473) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_859528

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YNPIIYQVIDYKFACCQTGGLKATKKKSLEGFRLHTVTTVRKSSAVLEIH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human FAM160A2 shRNA (UAS) - Lentiviral human FAM160A2 shRNA (UAS, iRFP) plasmid
GTR15077980 1 Vial

Lentiviral human FAM160A2 shRNA (UAS) - Lentiviral human FAM160A2 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Rabbit Polyclonal FAM98A Antibody [CoraFluor 1]
NBP2-99203CL1 0.1 mL

Rabbit Polyclonal FAM98A Antibody [CoraFluor 1]

Sign In for Pricing
View Details
Caspase 1 (CASP1) (NM_033294) Human Tagged Lenti ORF Clone
RC218982L3 10 µg

Caspase 1 (CASP1) (NM_033294) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Mouse Anti-Human CD4-APC
31-3361-25 25 Tests

Mouse Anti-Human CD4-APC

Sign In for Pricing
View Details
Human AZIN1 Recombinant Protein
PPT-10776 100 µg

Human AZIN1 Recombinant Protein

Sign In for Pricing
View Details
KN-62
C12674-1g 1 g

KN-62

Sign In for Pricing
View Details